PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00136703001
Common NameGSBRNA2T00136703001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 165aa    MW: 18253.8 Da    PI: 8.3786
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00136703001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.94.3e-44141131100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +Ca+Ck+lrrkCak+Cv+apyfpa++p kfa+vhk+FGasnv k+l+ l+e++r+da++slvyeA+ar++dPvyG+vg+i++l++qle+l
  GSBRNA2T00136703001  14 PCAGCKLLRRKCAKNCVFAPYFPAKEPYKFAIVHKIFGASNVNKMLQVLSENHRSDAVNSLVYEANARVQDPVYGCVGTISSLHRQLETL 103
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++la +++e
  GSBRNA2T00136703001 104 QTQLAIAQAE 113
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.41713114IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-4214111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MRPKGHRHGE AVSPCAGCKL LRRKCAKNCV FAPYFPAKEP YKFAIVHKIF GASNVNKMLQ  60
VLSENHRSDA VNSLVYEANA RVQDPVYGCV GTISSLHRQL ETLQTQLAIA QAELVHMQTL  120
HHVDTRSSPY MASSFTFPAI KDFSSDDNMA FMYDNGAGES LWSC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00136703001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013710686.11e-119PREDICTED: LOB domain-containing protein 3-like
SwissprotQ9SA517e-97LBD3_ARATH; LOB domain-containing protein 3
TrEMBLA0A078CY821e-123A0A078CY82_BRANA; BnaC08g38340D protein
STRINGBra026716.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.14e-98ASYMMETRIC LEAVES 2-like 9
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]